PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0312s0260.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 449aa    MW: 50139.9 Da    PI: 4.7021
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0312s0260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2813.4e-86424412373
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                             ++lL++cA a++++d +laq++++ l++ as  gdp+qRl++ f++AL +r ++ ++   +   + + +++++s +   l +++++ 
  SapurV1A.0312s0260.1.p  42 EKLLIHCASALEQNDGTLAQQVMWVLNNVASLVGDPNQRLTSWFLRALISRASKVCPAATDFDGSGTIRRRQMSVT--ELAVYVDLI 126
                             689***************************************************8888777665555554443333..33469**** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeel 172
                             P+++f++ + N+aI +a+eg ++vHi+Df+i++++QWp+L++aLa+RpegppslRiT+ +   ++    + + ee+g rL++fA+  
  SapurV1A.0312s0260.1.p 127 PWHRFGFCASNSAIFKAIEGYSKVHILDFSITHCMQWPTLIDALAKRPEGPPSLRITVPSCRPPVppfLNVSCEEVGLRLSNFAKFK 213
                             *********************************************************97775555668999**************** PP

                    GRAS 173 gvpfefnvl......................vakrledleleeLrvkpgEalaVnlvlqlhrll......desvsleserdevLklv 231
                             +vpfefnv+                       ++ l+ l++++L+++ +Eal++n++  l +l       d  ++++s rd++L++v
  SapurV1A.0312s0260.1.p 214 DVPFEFNVIdddpscfpspetipqesshefhFESLLNHLTPSMLNLRDDEALVINCQNWLRYLSntdqkgDVVQDSSSLRDAFLRTV 300
                             ***********************9999888555678889******************999999844444333334445899****** PP

                    GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                             k l+P ++vvv++++d+ ++s+  r++ +++y +  fd+le+ lp++s +r+ +E   +g++i+n+++ eg +r+er e+  +  +r
  SapurV1A.0312s0260.1.p 301 KFLNPCILVVVDEDSDLRAPSLSSRITACFNYLWIPFDALETFLPKDSTQRVEYESD-IGQKIENIISFEGLQRIERLESGIEVAQR 386
                             *********************************************************.***************************** PP

                    GRAS 319 leeaGFkpvplsekaakqaklllrkvk.sdgyrve.eesgslvlgWkdrpLvsvSaW 373
                             +++aGF++vp+ e++  ++++ll++++ ++   ++ ee++ +vl+Wk+++ v+++aW
  SapurV1A.0312s0260.1.p 387 MKNAGFSSVPFCEDTIGEVRSLLEEHAsGW--GMKrEEDHMVVLTWKGHNSVFATAW 441
                             ***************************555..55525566778************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.53415422IPR005202Transcription factor GRAS
PfamPF035141.2E-8342441IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MKTELRGSST TSISLQNPSL FNDPDESSLK GCLGSLDGAC IEKLLIHCAS ALEQNDGTLA  60
QQVMWVLNNV ASLVGDPNQR LTSWFLRALI SRASKVCPAA TDFDGSGTIR RRQMSVTELA  120
VYVDLIPWHR FGFCASNSAI FKAIEGYSKV HILDFSITHC MQWPTLIDAL AKRPEGPPSL  180
RITVPSCRPP VPPFLNVSCE EVGLRLSNFA KFKDVPFEFN VIDDDPSCFP SPETIPQESS  240
HEFHFESLLN HLTPSMLNLR DDEALVINCQ NWLRYLSNTD QKGDVVQDSS SLRDAFLRTV  300
KFLNPCILVV VDEDSDLRAP SLSSRITACF NYLWIPFDAL ETFLPKDSTQ RVEYESDIGQ  360
KIENIISFEG LQRIERLESG IEVAQRMKNA GFSSVPFCED TIGEVRSLLE EHASGWGMKR  420
EEDHMVVLTW KGHNSVFATA WVPGDLQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-27394412374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373000.10.0hypothetical protein POPTR_0017s06900g
TrEMBLU5FN460.0U5FN46_POPTR; Uncharacterized protein
STRINGPOPTR_0017s06900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-123GRAS family protein